Protein Info for NOLOHH_11520 in Escherichia coli ECOR27

Name: idi
Annotation: isopentenyl-diphosphate Delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02150: isopentenyl-diphosphate delta-isomerase
  • amino acids 6 to 165 (160 residues), 154.4 bits, E=1.2e-49
• PF00293: NUDIX
  • amino acids 31 to 161 (131 residues), 74.2 bits, E=5.1e-25

Best Hits

Swiss-Prot: 100% identical to IDI_ECO5E: Isopentenyl-diphosphate Delta-isomerase (idi) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K01823, isopentenyl-diphosphate delta-isomerase [EC: 5.3.3.2] (inferred from 97% identity to eco:b2889)

MetaCyc: 97% identical to isopentenyl-diphosphate Delta-isomerase (Escherichia coli K-12 substr. MG1655)
Isopentenyl-diphosphate Delta-isomerase. [EC: 5.3.3.2]

Predicted SEED Role

"Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis or polyprenyl synthesis (EC 5.3.3.2)

MetaCyc Pathways

• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• isoprene biosynthesis I (9/10 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• all-trans-farnesol biosynthesis (3/4 steps found)
• bisabolene biosynthesis (engineered) (3/6 steps found)
• mono-trans, poly-cis decaprenyl phosphate biosynthesis (2/5 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (2/7 steps found)
• mevalonate pathway II (haloarchaea) (2/7 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
• isoprene biosynthesis II (engineered) (2/8 steps found)
• mevalonate pathway III (Thermoplasma) (2/8 steps found)
• mevalonate pathway IV (archaea) (2/8 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (11/33 steps found)
• superpathway of ergosterol biosynthesis I (4/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
• superpathway of cholesterol biosynthesis (4/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.2

Protein Sequence (182 amino acids)

>NOLOHH_11520 isopentenyl-diphosphate Delta-isomerase (Escherichia coli ECOR27)
MQTEHVILLNAQGVPTGTLEKYAAHTADTRLHLAFSSWLFNAKGQLLVTRRALSKKAWPG
VWTNSVCGHPQLGESNEDAVIRRCRYELGVEITPPESIYPDFRYRATDPNGIVENEVCPV
FAARTTSALQINDDEVMDYQWCDLADVLHGIDATPWAFSPWMVMQAANSEARKLLSAFAQ
HN