Protein Info for NOLOHH_11485 in Escherichia coli ECOR27

Name: ygfX
Annotation: Inner membrane protein YgfX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 38 to 54 (17 residues), see Phobius details PF07254: Cpta_toxin" amino acids 3 to 131 (129 residues), 169.9 bits, see alignment E=1.5e-54

Best Hits

Swiss-Prot: 99% identical to YGFX_ECOLI: Inner membrane protein YgfX (ygfX) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2896)

Predicted SEED Role

"FIG00731769: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>NOLOHH_11485 Inner membrane protein YgfX (Escherichia coli ECOR27)
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRI
NARQGEIRLLMDGRLRWQGQEWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAE
WRDLRRILLQQETQR