Protein Info for NOLOHH_11465 in Escherichia coli ECOR27

Name: yqfA
Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details PF03006: HlyIII" amino acids 12 to 209 (198 residues), 134.1 bits, see alignment E=3.1e-43 TIGR01065: channel protein, hemolysin III family" amino acids 15 to 216 (202 residues), 241.7 bits, see alignment E=2.6e-76

Best Hits

Swiss-Prot: 100% identical to YQFA_ECOL6: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to eco:b2899)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>NOLOHH_11465 hemolysin III family protein (Escherichia coli ECOR27)
MVQKPLIKQGYSLAEEIANSVSHGIGLVFGIVGLVLLLVQAVDLNASATAITSYSLYGGS
MILLFLASTLYHAIPHQRAKMWLKKFDHCAIYLLIAGTYTPFLLVGLDSPLARGLMIVIW
SLALLGILFKLTIAHRFKILSLVTYLAMGWLSLVVIYEMAVKLAAGSVTLLAVGGVVYSL
GVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYIGQA