Protein Info for NOLOHH_10875 in Escherichia coli ECOR27

Name: lptF
Annotation: LPS export ABC transporter permease LptF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 78 (27 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 294 to 311 (18 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 4 to 345 (342 residues), 318.7 bits, see alignment E=1.8e-99 PF03739: LptF_LptG" amino acids 7 to 344 (338 residues), 181.8 bits, see alignment E=9.3e-58

Best Hits

KEGG orthology group: None (inferred from 98% identity to ecx:EcHS_A3160)

Predicted SEED Role

"Permease Ygh-P1, YjgP/YjgQ family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>NOLOHH_10875 LPS export ABC transporter permease LptF (Escherichia coli ECOR27)
MKLVEHYIMRGTRRLVLIIVGFLIFIFASYSAQRYLTEAANGTLALDVVLDIVFYKVLIA
LEMLLPVGLYVSVGVTLGQMYTDSEITAISAAGGSPGRLYKAVLYLAIPLSIFVTLLSMY
GRPWAYTQIYQLEQQSQSELDVRQLRAKKFNTNDNGRMILSQTVDQDNNRLTDALIYTST
ANRTRIFRARSVDVVDPSPEKPTVMLHNGTAYLLDHQGRDDNEQIYRNLQLHLNPLDQSP
NVKRKAKSVTELARSAFPADHAELQWRQSRGLTALLMALLAISLSRVKPRQGRFSTLLPL
TLLFIAIFYGGDVCRTLVANGAIPLIPGLWLVPGLMLMGLLMLVARDFSLLQKFSR