Protein Info for NOLOHH_09845 in Escherichia coli ECOR27

Name: greA
Annotation: transcription elongation factor GreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03449: GreA_GreB_N
  • amino acids 4 to 74 (71 residues), 111.1 bits, E=2.4e-36
• TIGR01462: transcription elongation factor GreA
  • amino acids 5 to 156 (152 residues), 202.6 bits, E=1.7e-64
• PF01272: GreA_GreB
  • amino acids 83 to 157 (75 residues), 104.4 bits, E=2.4e-34

Best Hits

Swiss-Prot: 100% identical to GREA_ECOL6: Transcription elongation factor GreA (greA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 100% identity to eco:b3181)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Protein Sequence (158 amino acids)

>NOLOHH_09845 transcription elongation factor GreA (Escherichia coli ECOR27)
MQAIPMTLRGAEKLREELDFLKSVRRPEIIAAIAEAREHGDLKENAEYHAAREQQGFCEG
RIKDIEAKLSNAQVIDVTKMPNNGRVIFGATVTVLNLDSDEEQTYRIVGDDEADFKQNLI
SVNSPIARGLIGKEEDDVVVIKTPGGEVEFEVIKVEYL