Protein Info for NOLOHH_09655 in Escherichia coli ECOR27

Name: nanT
Annotation: sialic acid transporter NanT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 366 to 391 (26 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details amino acids 432 to 452 (21 residues), see Phobius details TIGR00891: MFS transporter, sialate:H+ symporter (SHS) family" amino acids 9 to 442 (434 residues), 647.1 bits, see alignment E=5.9e-199 PF00083: Sugar_tr" amino acids 24 to 200 (177 residues), 75.1 bits, see alignment E=5.5e-25 PF07690: MFS_1" amino acids 26 to 291 (266 residues), 95.1 bits, see alignment E=4.3e-31 amino acids 280 to 454 (175 residues), 49.7 bits, see alignment E=2.6e-17

Best Hits

Swiss-Prot: 100% identical to NANT_ECO8A: Sialic acid transporter NanT (nanT) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K03290, MFS transporter, SHS family, sialic acid transporter (inferred from 100% identity to eco:b3224)

MetaCyc: 100% identical to N-acetylneuraminate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-15314

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>NOLOHH_09655 sialic acid transporter NanT (Escherichia coli ECOR27)
MSTTTQNIPWYRHLNRAQWRAFSAAWLGYLLDGFDFVLIALVLTEVQGEFGLTTVQAASL
ISAAFISRWFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGM
GMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIG
ILPIIFALWLRKNIPEAEDWKEKHAGKAPVRTMVDILYRGEHRIANIVMTLAAATALWFC
FAGNLQNAAIVAVLGLLCAAIFISFMVQSTGKRWPTGVMLMVVVLFAFLYSWPIQALLPT
YLKTDLAYNPHTVANVLFFSGFGAAVGCCVGGFLGDWLGTRKAYVCSLLASQLLIIPVFA
IGGANVWVLGLLLFFQQMLGQGIAGILPKLIGGYFDTDQRAAGLGFTYNVGALGGALAPI
IGALIAQRLDLGTALASLSFSLTFVVILLIGLDMPSRVQRWLRPEALRTHDAIDGKPFSG
AVPFGSAKNDLVKTKS