Protein Info for NOLOHH_09135 in Escherichia coli ECOR27

Name: tufA_E379K
Annotation: translation elongation factor EF-Tu 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR00485: translation elongation factor Tu" amino acids 2 to 393 (392 residues), 792.9 bits, see alignment E=4.6e-243 PF00009: GTP_EFTU" amino acids 10 to 201 (192 residues), 215 bits, see alignment E=1.1e-67 TIGR00231: small GTP-binding protein domain" amino acids 13 to 148 (136 residues), 52 bits, see alignment E=7.1e-18 PF03144: GTP_EFTU_D2" amino acids 225 to 294 (70 residues), 72.8 bits, see alignment E=3.9e-24 PF03143: GTP_EFTU_D3" amino acids 298 to 392 (95 residues), 137.8 bits, see alignment E=2.4e-44

Best Hits

Swiss-Prot: 100% identical to EFTU1_ECOLI: Elongation factor Tu 1 (tufA) from Escherichia coli (strain K12)

KEGG orthology group: K02358, elongation factor Tu (inferred from 100% identity to eco:b3339)

Predicted SEED Role

"Translation elongation factor Tu" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>NOLOHH_09135 translation elongation factor EF-Tu 1 (Escherichia coli ECOR27)
VSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKILELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG