Protein Info for NOLOHH_08560 in Escherichia coli ECOR27

Name: ugpB
Annotation: sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01547: SBP_bac_1" amino acids 38 to 337 (300 residues), 133.7 bits, see alignment E=1.5e-42 PF13416: SBP_bac_8" amino acids 44 to 368 (325 residues), 141.7 bits, see alignment E=4.1e-45

Best Hits

Swiss-Prot: 100% identical to UGPB_ECO57: sn-glycerol-3-phosphate-binding periplasmic protein UgpB (ugpB) from Escherichia coli O157:H7

KEGG orthology group: K05813, sn-glycerol 3-phosphate transport system substrate-binding protein (inferred from 100% identity to eco:b3453)

MetaCyc: 100% identical to sn-glycerol 3-phosphate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>NOLOHH_08560 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB (Escherichia coli ECOR27)
MKPLHYTASALALGLALMGNAQAVTTIPFWHSMEGELGKEVDSLAQRFNAENPDYKIVPT
YKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYDVFKEAGIQFDESQF
VPTVSGYYSDSKTGHLLSQPFNSSTPVLYYNKDAFKKAGLDPEQPPKTWQDLADYAAKLK
ASGMKCGYASGWQGWIQLENFSAWNGLPFASKNNGFDGTDAVLEFNKPEQVKHIAMLEEM
NKKGDFSYVGRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMPYDADAKDAP
QNAIIGGASLWVMQGKNKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQ
GFYEKNPGADTATRQMLNKPPLPFTKGLRLGNMPQIRVIVDEELESVWTGKKTPQQALDT
AVERGNQLLRRFEKSTKS