Protein Info for NOLOHH_08130 in Escherichia coli ECOR27

Name: bcsQ
Annotation: cellulose biosynthesis protein BcsQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR03371: cellulose synthase operon protein YhjQ" amino acids 1 to 239 (239 residues), 297.5 bits, see alignment E=3.7e-93 PF06564: CBP_BcsQ" amino acids 1 to 236 (236 residues), 383 bits, see alignment E=1e-118 PF13614: AAA_31" amino acids 5 to 149 (145 residues), 35.1 bits, see alignment E=2.6e-12 PF01656: CbiA" amino acids 7 to 215 (209 residues), 28 bits, see alignment E=3.8e-10 PF02374: ArsA_ATPase" amino acids 9 to 55 (47 residues), 24.7 bits, see alignment 2.7e-09

Best Hits

Swiss-Prot: 100% identical to BCSQ_ECOLI: Cellulose biosynthesis protein BcsQ (bcsQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ece:Z4950m)

Predicted SEED Role

"Cellulose synthase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>NOLOHH_08130 cellulose biosynthesis protein BcsQ (Escherichia coli ECOR27)
MAVLGLQGVRGGVGTTTITAALAWSLQMLGENVLVVDACPDNLLRLSFNVDFTHRQGWAR
AMLDGQDWRDAGLRYTSQLDLLPFGQLSIEEQENPQHWQTRLSDICSGLQQLKASGRYQW
ILIDLPRDASQITHQLLSLCDHSLAIVNVDANCHIRLHQQALPDGAHILINDFRIGSQVQ
DDIYQLWLQSQRRLLPMLIHRDEAMAECLAAKQPVGEYRSDALAAEEILTLANWCLLNYS
GLKTPVGSAS