Protein Info for NOLOHH_08120 in Escherichia coli ECOR27

Name: bcsE
Annotation: cellulose biosynthesis protein BcsE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 PF10995: CBP_BcsE" amino acids 2 to 510 (509 residues), 768.8 bits, see alignment E=1.3e-235 TIGR03369: cellulose biosynthesis protein BcsE" amino acids 157 to 471 (315 residues), 416.8 bits, see alignment E=2.8e-129

Best Hits

Swiss-Prot: 100% identical to BCSE_ECOLI: Cyclic di-GMP binding protein BcsE (bcsE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3536)

Predicted SEED Role

"FIG005274: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>NOLOHH_08120 cellulose biosynthesis protein BcsE (Escherichia coli ECOR27)
VDPVFSIGISSLWDELRHMPAGGVWWFNVDRHEDAISLANQTIASQAETAHVAVISMDSD
PAKIFQLDDSQGPEKIKLFSMLNHEKGLYYLTRDLQCSIDPHNYLFILVCANNAWQNIPA
ERLRSWLDKMNKWSRLNHCSLLVINPGNNNDKQFSLLLEEYRSLFGLASLRFQGDQHLLD
IAFWCNEKGVSARQQLSVQQQNGIWTLVQSEEAEIQPRSDEKRILSNVAVLEGAPPLSEH
WQLFNNNEVLFNEARTAQAATVVFSLQQNAQIEPLARSIHTLRRQRGSAMKILVRENTAS
LRATDERLLLACGANMVIPWNAPLSRCLTMIESVQGQKFSRYVPEDITTLLSMTQPLKLR
GFQKWDVFCNAVNNMMNNPLLPAHGKGVLVALRPVPGIRVEQALTLCRPNRTGDIMTIGG
NRLVLFLSFCRINDLDTALNHIFPLPTGDIFSNRMVWFEDDQISAELVQMRLLAPEQWGM
PLPLTQSSKPVINAEHDGRHWRRIPEPMRLLDDAVERSS