Protein Info for NOLOHH_08020 in Escherichia coli ECOR27

Name: lpfE
Annotation: long polar fimbrial protein LpfE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00419: Fimbrial" amino acids 31 to 174 (144 residues), 63.2 bits, see alignment E=1.8e-21

Best Hits

Swiss-Prot: 54% identical to LPFE_SALTY: Protein LpfE (lpfE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to eoh:ECO103_4692)

Predicted SEED Role

"putative fimbrial protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>NOLOHH_08020 long polar fimbrial protein LpfE (Escherichia coli ECOR27)
MKRTILALCLLPLSFSSFAATTDLGPKGTLKFTLKISQGACELVKDSVEVDMGTAVLKKP
VRIGTEINPTPFSIGLKNCSEVVRAYVTMDGTPNADDSNLFALDAGGATGVGLKIKTAAG
VQQFPENTTPTPVEFAINGDGAHQLNYIASYVPIRADATIGRADATVDFTVQYE