Protein Info for NOLOHH_07995 in Escherichia coli ECOR27

Name: yhjX
Annotation: Uncharacterized MFS-type transporter YhjX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details TIGR00890: oxalate/formate antiporter family transporter" amino acids 9 to 383 (375 residues), 477 bits, see alignment E=2e-147 PF07690: MFS_1" amino acids 26 to 232 (207 residues), 71.6 bits, see alignment E=2.9e-24 amino acids 220 to 393 (174 residues), 56.7 bits, see alignment E=1e-19

Best Hits

Swiss-Prot: 99% identical to YHJX_ECOLI: Uncharacterized MFS-type transporter YhjX (yhjX) from Escherichia coli (strain K12)

KEGG orthology group: K08177, MFS transporter, OFA family, oxalate/formate antiporter (inferred from 99% identity to eco:b3547)

Predicted SEED Role

"Putative resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>NOLOHH_07995 Uncharacterized MFS-type transporter YhjX (Escherichia coli ECOR27)
MTPSNYQRTRWLTLIGTIITQFALGSVYTWSLFNGALSAKLDAPVSQVAFSFGLLSLGLA
ISSSVAGKLQERFGVKRVTMASGILLGLGFFLTAHSNNLMMLWLSAGVLVGLADGAGYLL
TLSNCVKWFPERKGLISAFAIGSYGLGSLGFKFIDTQLLETVGLEKTFVIWGAIALVMIV
FGATLMKDAPKQEVKTSNGVVEKDYTLAESMRKPQYWMLAVMFLTACMSGLYVIGVAKDI
AQSLAHLDVVSAANAVTVISIANLSGRLVLGILSDKIARIRVITIGQVISLVGMAALLFA
PLNAVTFFAAIACVAFNFGGTITVFPSLVSEFFGLNNLAKNYGVIYLGFGIGSICGSIIA
SLFGGFYVTFYVIFALLILSLALSTTIRQPEQKVLREAHI