Protein Info for NOLOHH_07955 in Escherichia coli ECOR27

Name: yiaG
Annotation: HTH-type transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 96 PF01381: HTH_3" amino acids 38 to 80 (43 residues), 26.2 bits, see alignment E=3.2e-10

Best Hits

Swiss-Prot: 100% identical to YIAG_ECO57: Uncharacterized HTH-type transcriptional regulator YiaG (yiaG) from Escherichia coli O157:H7

KEGG orthology group: K07726, putative transcriptional regulator (inferred from 100% identity to eco:b3555)

Predicted SEED Role

"FIG00638451: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (96 amino acids)

>NOLOHH_07955 HTH-type transcriptional regulator (Escherichia coli ECOR27)
MEYKDPMHELLSSLEQIVFKDETQKITLTHRTTSCTEIEQLRKGTGLKIDDFARVLGVSV
AMVKEWESRRVKPSSAELKLMRLIQANPALSKQLME