Protein Info for NOLOHH_07755 in Escherichia coli ECOR27

Name: aldB
Annotation: aldehyde dehydrogenase AldB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 33 to 498 (466 residues), 542.8 bits, E=2.9e-167

Best Hits

Swiss-Prot: 100% identical to ALDB_ECOLI: Aldehyde dehydrogenase B (aldB) from Escherichia coli (strain K12)

KEGG orthology group: K00138, aldehyde dehydrogenase [EC: 1.2.1.-] (inferred from 100% identity to eco:b3588)

MetaCyc: 100% identical to aldehyde dehydrogenase B (Escherichia coli K-12 substr. MG1655)
Aldehyde dehydrogenase (NADP(+)). [EC: 1.2.1.4]

Predicted SEED Role

No annotation

MetaCyc Pathways

• cytosolic NADPH production (yeast) (4/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• L-carnitine degradation II (2/3 steps found)
• pyruvate fermentation to acetate VIII (1/2 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Caprolactam degradation
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.4

Protein Sequence (512 amino acids)

>NOLOHH_07755 aldehyde dehydrogenase AldB (Escherichia coli ECOR27)
MTNNPPSAQIKPGEYGFPLKLKARYDNFIGGEWVAPADGEYYQNLTPVTGQLLCEVASSG
KRDIDLALDAAHKVKDKWAHTSVQDRAAILFKIADRMEQNLELLATAETWDNGKPIRETS
AADVPLAIDHFRYFASCIRAQEGGISEVDSETVAYHFHEPLGVVGQIIPWNFPLLMASWK
MAPALAAGNCVVLKPARLTPLSVLLLMEIVGDLLPPGVVNVVNGAGGEIGEYLATSKRIA
KVAFTGSTEVGQQIMQYATQNIIPVTLELGGKSPNIFFADVMDEEDAFFDKALEGFALFA
FNQGEVCTCPSRALVQESIYERFMERAIRRVESIRSGNPLDSVTQMGAQVSHGQLETILN
YIDIGKKEGADVLTGGRRKLLEGELKDGYYLEPTILFGQNNMRVFQEEIFGPVLAVTTFK
TMEEALELANDTQYGLGAGVWSRNGNLAYKMGRGIQAGRVWTNCYHAYPAHAAFGGYKQS
GIGRETHKMMLEHYQQTKCLLVSYSDKPLGLF