Protein Info for NOLOHH_07425 in Escherichia coli ECOR27

Name: recG
Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF17191: RecG_wedge" amino acids 15 to 171 (157 residues), 72 bits, see alignment E=2e-23 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 29 to 664 (636 residues), 838.6 bits, see alignment E=1.9e-256 PF01336: tRNA_anti-codon" amino acids 63 to 135 (73 residues), 40.3 bits, see alignment E=1.1e-13 PF00270: DEAD" amino acids 272 to 436 (165 residues), 92.2 bits, see alignment E=1.5e-29 PF04851: ResIII" amino acids 273 to 430 (158 residues), 44.9 bits, see alignment E=5.4e-15 PF07517: SecA_DEAD" amino acids 293 to 360 (68 residues), 26.7 bits, see alignment E=1.5e-09 PF00176: SNF2-rel_dom" amino acids 297 to 435 (139 residues), 24.8 bits, see alignment E=5.2e-09 PF00271: Helicase_C" amino acids 481 to 587 (107 residues), 67.1 bits, see alignment E=7.2e-22 PF19833: RecG_dom3_C" amino acids 617 to 676 (60 residues), 40.5 bits, see alignment 1.1e-13

Best Hits

Swiss-Prot: 99% identical to RECG_ECOLI: ATP-dependent DNA helicase RecG (recG) from Escherichia coli (strain K12)

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 100% identity to eck:EC55989_4118)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (693 amino acids)

>NOLOHH_07425 ATP-dependent DNA helicase RecG (Escherichia coli ECOR27)
MKGRLLDAVPLSSLTGVGAALSNKLAKINLHTVQDLLLHLPLRYEDRTHLYPIGELLPGV
YATVEGEVLNCNISFGGRRMMTCQISDGSGILTMRFFNFSAAMKNSLATGRRVLAYGEAK
RGKYGAEMIHPEYRVQGDLSTPELQETLTPVYPTTEGVKQATLRKLTDQALDLLDTCAIE
ELLPPELSQGMMTLPEALRTLHRPPPTLQLSDLETGQHPAQRRLILEELLAHNLSMLALR
AGAQRFHAQPLSANDTLKNKLLAALPFKPTGAQARVVAEIEHDMALDVPMMRLVQGDVGS
GKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRNWFAPLGIKVGWLAGKQKGKAR
LSQQEAIASGQVQMIVGTHAIFQEQVQFNGLALVIIDEQHRFGVHQRLALWEKGQQQGFH
PHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPVTTVAIPDTRRTDIIDRVRHACI
TEGRQAYWVCTLIEESELLEAQAAEATWEELKLALPELNVGLVHGRMKPAEKQAVMASFK
QGELHLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGAVASHCVLLYKT
PLSKTAQIRLQVLRDSNDGFVIAQKDLEIRGPGELLGTRQTGNAEFKVADLLRDQAMIPE
VQRLARHIHERYPQQAKALIERWMPETERYSNA