Protein Info for NOLOHH_07075 in Escherichia coli ECOR27

Name: cbrB
Annotation: Inner membrane protein CbrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 45 to 71 (27 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details

Best Hits

Swiss-Prot: 98% identical to CBRB_SHIFL: Inner membrane protein CbrB (cbrB) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to eoi:ECO111_4543)

Predicted SEED Role

"FIG00638032: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>NOLOHH_07075 Inner membrane protein CbrB (Escherichia coli ECOR27)
MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLLRRIQVLPLFLLLSITTGVIP
ALLTGVMVACLPEKIGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGD
SLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS