Protein Info for NOLOHH_07070 in Escherichia coli ECOR27

Name: cbrC
Annotation: PF03691 family colicin E2 tolerance protein CbrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF03691: UPF0167" amino acids 8 to 194 (187 residues), 235.6 bits, see alignment E=1.6e-74

Best Hits

Swiss-Prot: 99% identical to CBRC_ECOLI: UPF0167 protein CbrC (cbrC) from Escherichia coli (strain K12)

KEGG orthology group: K09925, hypothetical protein (inferred from 99% identity to eco:b3717)

Predicted SEED Role

"FIG00638764: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>NOLOHH_07070 PF03691 family colicin E2 tolerance protein CbrC (Escherichia coli ECOR27)
MTQNIRPLPQFKYHPKPLETGAFEQDKTVECDCCEQQTSVYYSGPFYCVDEVEHLCPWCI
ADGSAAEKFAGSFQDDASIEGVEFEYDEEDEFAGIKNTYPDEMLKELVERTPGYHGWQQE
FWLAHCGDFCAFIGYVGWNDIKDRLDEFANLEEDCENFGIRNSDLAKCLQKGGDCQGYLF
RCLHCGKLRLWGDFS