Protein Info for NOLOHH_07055 in Escherichia coli ECOR27

Name: bglH
Annotation: carbohydrate-specific porin BglH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF11471: Sugarporin_N" amino acids 29 to 59 (31 residues), 42.9 bits, see alignment (E = 4.4e-15) PF02264: LamB" amino acids 127 to 538 (412 residues), 301.8 bits, see alignment E=1.5e-93

Best Hits

Swiss-Prot: 100% identical to BGLH_SHISS: Putative outer membrane porin BglH (bglH) from Shigella sonnei (strain Ss046)

KEGG orthology group: K10124, carbohydrate-specific outer membrane porin (inferred from 99% identity to eco:b3720)

Predicted SEED Role

"Maltoporin (maltose/maltodextrin high-affinity receptor, phage lambda receptor protein)" in subsystem Maltose and Maltodextrin Utilization or Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (538 amino acids)

>NOLOHH_07055 carbohydrate-specific porin BglH (Escherichia coli ECOR27)
MFRRNLITSAILLMAPLAFSAQSLAESLTVEHRLELLEKALRETQSELKKYKDEEKKKYT
PATVNRSVSTNDQGYAANPFPTSSAAKPDAVLVKNEEKNASETGSIYSSMTLKDFSKFVK
DEIGFSYNGYYRSGWGTASHGSPKSWAIGSLGRFGNEYSGWFDLQLKQRVYNENGKRVDA
VVMMDGNVGQQYSTGWFGDNAGGENFMQFSDMYVTTKGFLPFAPEADFWVGKHGAPKIEI
QMLDWKTQRTDAAAGVGLENWKVGPGKIDIALVREDVDDYDRSLQNKQQINTNTIDLRYK
DIPLWDKATLMVSGRYVTANESASEKDNQDNNGYYDWKDTWMFGTSLTQKFDKGGFNEFS
FLVANNSIASNFGRYAGASPFTTFNGRYYGDHTGGTAVRLTSQGEAYIGDHFIVANAIVY
SFGNDIYSYETGAHSDFESIRAVVRPAYILDQYNQTGVELGYFTQQNKDANSNKFNESGY
KTTLFHTFKVNTSMLTSRPEIRFYATYIKALENELDGFTFEDNKDDQFAVGAQAEIWW