Protein Info for NOLOHH_07045 in Escherichia coli ECOR27

Name: bglF
Annotation: PTS beta-glucoside transporter subunit IIABC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 transmembrane" amino acids 100 to 121 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 269 to 271 (3 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details amino acids 405 to 421 (17 residues), see Phobius details amino acids 428 to 452 (25 residues), see Phobius details TIGR01995: PTS system, beta-glucoside-specific IIABC component" amino acids 3 to 623 (621 residues), 704 bits, see alignment E=3.4e-215 PF00367: PTS_EIIB" amino acids 6 to 38 (33 residues), 56.5 bits, see alignment (E = 2.3e-19) TIGR00826: PTS system, glucose-like IIB component" amino acids 26 to 106 (81 residues), 54.5 bits, see alignment E=2.3e-18 PF02378: PTS_EIIC" amino acids 106 to 389 (284 residues), 116.8 bits, see alignment E=1.7e-37 TIGR00852: PTS system, maltose and glucose-specific subfamily, IIC component" amino acids 148 to 433 (286 residues), 296.9 bits, see alignment E=3.1e-92 TIGR00830: PTS system, glucose subfamily, IIA component" amino acids 479 to 599 (121 residues), 148.9 bits, see alignment E=1.3e-47 PF00358: PTS_EIIA_1" amino acids 479 to 602 (124 residues), 159 bits, see alignment E=6.7e-51

Best Hits

Swiss-Prot: 99% identical to PTV3B_ECOLI: PTS system beta-glucoside-specific EIIBCA component (bglF) from Escherichia coli (strain K12)

KEGG orthology group: K02755, PTS system, beta-glucosides-specific IIA component [EC: 2.7.1.69] K02756, PTS system, beta-glucosides-specific IIB component [EC: 2.7.1.69] K02757, PTS system, beta-glucosides-specific IIC component (inferred from 100% identity to ecw:EcE24377A_4231)

MetaCyc: 99% identical to beta-glucoside specific PTS enzyme II / BglG kinase / BglG phosphatase (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-153A [EC: 2.7.1.199]; 2.7.1.199 [EC: 2.7.1.199]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.199 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (625 amino acids)

>NOLOHH_07045 PTS beta-glucoside transporter subunit IIABC (Escherichia coli ECOR27)
MTELARKIVAGVGGADNIVSLMHCATRLRFKLKDESKAQAEVLKNTPGIIMVVESGGQFQ
VVIGNHVADVFLAVNSVAGLGEKAQQAPENDEKGNLLNRFVYVISGIFTPLIGLMAATGI
LKGMLALALTFQWTTEQSGTYLILFSASDALFWFFPIILGYTAGKRFGGNPFTAMVIGGA
LVHPLILTAFENGQKADELGLDFLGIPVTLLNYSSSVIPIIFSAWLCSILERRLNAWLPS
AIKNFFTPLLCLMVITPVTFLLVGPLSTWISELIAAGYLWLYQAVPAFAGAVMGGFWQIF
VMFGLHWGLVPLCINNFTVLGYDTMIPLLMPAIMAQVGAALGVFLCERDAQKKVVAGSAA
LTGLFGITEPAVYGVNLPRKYPFVIACISGALGATIIGYAQTKVYSFGLPSIFTFMQTIP
STGIDFTVWASVIGGVIAIGCAFVGTVMLHFITAKRQPAQGAPQEKTPEVITPPEQGGIC
SPMTGEIVPLIHVADTTFASGLLGKGIAILPSVGEVRSPVAGRIASLFATLHAIGIESDD
GVEILIHVGIDTVKLDGKFFSAHVNVGDKVNTGDRLISFDIPAIREAGFDLTTPVLISNS
DDFTDVLPHGTAQISAGEPLLSIIR