Protein Info for NOLOHH_06985 in Escherichia coli ECOR27

Name: glmS
Annotation: glutamine--fructose-6-phosphate transaminase (isomerizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)" amino acids 2 to 609 (608 residues), 899.8 bits, see alignment E=4.4e-275 PF13230: GATase_4" amino acids 55 to 129 (75 residues), 25.5 bits, see alignment E=1.2e-09 PF13522: GATase_6" amino acids 64 to 182 (119 residues), 71.2 bits, see alignment E=1.7e-23 PF13537: GATase_7" amino acids 85 to 195 (111 residues), 56.1 bits, see alignment E=7.6e-19 PF01380: SIS" amino acids 290 to 418 (129 residues), 118 bits, see alignment E=5.1e-38 amino acids 462 to 591 (130 residues), 104.8 bits, see alignment E=6.3e-34

Best Hits

Swiss-Prot: 100% identical to GLMS_ECOLI: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Escherichia coli (strain K12)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 100% identity to eco:b3729)

MetaCyc: 100% identical to L-glutamine--D-fructose-6-phosphate aminotransferase (Escherichia coli K-12 substr. MG1655)
Glutamine--fructose-6-phosphate transaminase (isomerizing). [EC: 2.6.1.16]

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>NOLOHH_06985 glutamine--fructose-6-phosphate transaminase (isomerizing) (Escherichia coli ECOR27)
MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAE
EHPLHGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENYEPLREELKARGYTFV
SETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDSRHPDTLLAARSGSPLV
IGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDKTGAEVKRQDIESNLQ
YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILA
CGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGL
RLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKL
SRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIA
LEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRAR
GGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPR
NLAKSVTVE