Protein Info for NOLOHH_06685 in Escherichia coli ECOR27

Name: rffC
Annotation: dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02382: TDP-D-fucosamine acetyltransferase
  • amino acids 44 to 224 (181 residues), 319.2 bits, E=4.1e-100
• PF00583: Acetyltransf_1
  • amino acids 120 to 208 (89 residues), 26.9 bits, E=5e-10

Best Hits

Swiss-Prot: 98% identical to WECD_ECOL6: dTDP-fucosamine acetyltransferase (wecD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to eoj:ECO26_4796)

MetaCyc: 97% identical to RffC (Escherichia coli K-12 substr. MG1655)
TDPFUCACTRANS-RXN [EC: 2.3.1.210]

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein RffC"

MetaCyc Pathways

• superpathway of enterobacterial common antigen biosynthesis (9/10 steps found)
• dTDP-N-acetylthomosamine biosynthesis (4/4 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.210

Protein Sequence (224 amino acids)

>NOLOHH_06685 dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase (Escherichia coli ECOR27)
VPVRASIEPLTWENAFFGVNSAIVRITSEAPLLTPDVLAPWSRVQAKIAASNTGELDALQ
QLGFSLVEGEVDLALPVNNVSDSGAVVAQETDIPALRQLASAAFAQSRFRAPWYAPDASR
RFYAQWIENAVRGTFDHQCLILRAASGGIRGYVSLRELNATDARIGLLAGRGVGAELMQT
ALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR