Protein Info for NOLOHH_06300 in Escherichia coli ECOR27

Name: dsbA
Annotation: thiol:disulfide interchange protein DsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 39 to 183 (145 residues), 36.3 bits, see alignment E=6.6e-13 PF01323: DSBA" amino acids 40 to 197 (158 residues), 113.2 bits, see alignment E=1.3e-36

Best Hits

Swiss-Prot: 100% identical to DSBA_ECOLI: Thiol:disulfide interchange protein DsbA (dsbA) from Escherichia coli (strain K12)

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 100% identity to eco:b3860)

MetaCyc: 100% identical to thiol:disulfide oxidoreductase DsbA (Escherichia coli K-12 substr. MG1655)
RXN-21426 [EC: 1.8.4.15]; 1.8.4.15 [EC: 1.8.4.15]

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>NOLOHH_06300 thiol:disulfide interchange protein DsbA (Escherichia coli ECOR27)
MKKIWLALAGLVLAFSASAAQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLH
ISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQT
IRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQL
NPQGMDTSNMDVFVQQYADTVKYLSEKK