Protein Info for NOLOHH_06195 in Escherichia coli ECOR27

Name: ompL
Annotation: porin OmpL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF06178: KdgM" amino acids 14 to 230 (217 residues), 304.1 bits, see alignment E=6.4e-95

Best Hits

Swiss-Prot: 99% identical to OMPL_ECOLI: Porin OmpL (ompL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b3875)

Predicted SEED Role

"Outer membrane sugar transport protein YshA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>NOLOHH_06195 porin OmpL (Escherichia coli ECOR27)
MKKINAIILLSSLTSASVFAGAYVENREAYNLASDQGEVMLRVGYNFDMGAGIMLTNTYT
FQREDELKHGYNEIEGWYPLFKPTDKLTIQPGGLINDKSIGSGGAVYLDVNYKFVPWFNL
TVRNRYNHNNYSSTDLSGELDNNDTYEIGTYWNFKITDKFSYTFEPHYFMRVNDFNSSNG
KDHHWEITNTFRYRINENWLPYFELRWLDRNVEPYHREQNQIRIGTKYFF