Protein Info for NOLOHH_06045 in Escherichia coli ECOR27

Name: frvA
Annotation: PTS fructose transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00848: PTS system, fructose subfamily, IIA component
  • amino acids 4 to 130 (127 residues), 145.2 bits, E=5e-47
• PF00359: PTS_EIIA_2
  • amino acids 4 to 144 (141 residues), 118 bits, E=1.7e-38

Best Hits

Swiss-Prot: 94% identical to PTFLA_ECOLI: PTS system fructose-like EIIA component (frvA) from Escherichia coli (strain K12)

KEGG orthology group: K11201, PTS system, fructose-specific IIA-like component [EC: 2.7.1.69] (inferred from 100% identity to ecr:ECIAI1_4105)

MetaCyc: 94% identical to putative PTS enzyme IIA component FrvA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (148 amino acids)

>NOLOHH_06045 PTS fructose transporter subunit IIA (Escherichia coli ECOR27)
MAALTASCIDLNIQGNGAYSILKQLATMALQNGFITDSHQFLQTLLLREKMHSTGFGSGI
AVPHGKSACVKQPFVLFARKAQAIDWKASDGEDVNCWICLGVPQSGEEDQVKIIGTLCRK
IIHQDFIHQLRRGDADQVFALLNQTLSS