Protein Info for NOLOHH_06015 in Escherichia coli ECOR27

Name: rhaR
Annotation: HTH-type transcriptional activator RhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF02311: AraC_binding" amino acids 52 to 182 (131 residues), 82.3 bits, see alignment E=5.7e-27 PF07883: Cupin_2" amino acids 57 to 109 (53 residues), 28 bits, see alignment 3e-10 PF00165: HTH_AraC" amino acids 215 to 256 (42 residues), 31.8 bits, see alignment 2.3e-11 amino acids 267 to 306 (40 residues), 45.8 bits, see alignment 9.7e-16 PF12833: HTH_18" amino acids 229 to 305 (77 residues), 80.3 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 100% identical to RHAR_SHIF8: HTH-type transcriptional activator RhaR (rhaR) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K02854, AraC family transcriptional regulator, L-rhamnose operon transcriptional activator RhaR (inferred from 98% identity to sdy:SDY_3840)

Predicted SEED Role

"L-rhamnose operon transcriptional activator RhaR" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>NOLOHH_06015 HTH-type transcriptional activator RhaR (Escherichia coli ECOR27)
MVFCNNANLLNVFVRHIANNQLRSLAEVATVAHQLKLLKDDFFASDQQAVAVADRYPQDV
FAEHTHDFCELVIVWRGNGLHVLNDRPYRITRGDLFYIHADDKHSYASVNDLVLQNIIYC
PERLKLNLDWQGAIPGFSASAGQPHWRLGSVGMAQARQVIGQLEHESSQHVPFANEMAEL
LFGQLVMLLNRHRYTSDSLPPTSSETLLDKLITRLAASLKSPFALDKFCDEASCSERVLR
QQFRQQTGMTINQYLRQVRVCHAQYLLQHSRLLISDISTECGFEDSNYFSVVFTRETGMT
PSQWRHLNSQKD