Protein Info for NOLOHH_06000 in Escherichia coli ECOR27

Name: kdgT
Annotation: 2-keto-3-deoxygluconate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 218 to 218 (1 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details TIGR00793: 2-keto-3-deoxygluconate transporter" amino acids 1 to 314 (314 residues), 617.6 bits, see alignment E=2.6e-190 PF03812: KdgT" amino acids 3 to 312 (310 residues), 392.2 bits, see alignment E=9.5e-122

Best Hits

Swiss-Prot: 100% identical to KDGT_ECOLC: 2-keto-3-deoxygluconate permease (kdgT) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K02526, 2-keto-3-deoxygluconate permease (inferred from 100% identity to eco:b3909)

MetaCyc: 100% identical to 2-dehydro-3-deoxy-D-gluconate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-113

Predicted SEED Role

"2-keto-3-deoxygluconate permease (KDG permease)" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>NOLOHH_06000 2-keto-3-deoxygluconate transporter (Escherichia coli ECOR27)
MQIKRSIEKIPGGMMLVPLFLGALCHTFSPGAGKYFGSFTNGMITGTVPILAVWFFCMGA
SIKLSATGTVLRKSGTLVVTKIAVAWVVAAIASRIIPEHGVEVGFFAGLSTLALVAAMDM
TNGGLYASIMQQYGTKEEAGAFVLMSLESGPLMTMIILGTAGIASFEPHVFVGAVLPFLV
GFALGNLDPELREFFSKAVQTLIPFFAFALGNTIDLTVIAQTGLLGILLGVAVIIVTGIP
LIIADKLIGGGDGTAGIAASSSAGAAVATPVLIAEMVPAFKPMAPAATSLVATAVIVTSI
LVPILTSIWSRKVKARAAKIEILGTVK