Protein Info for NOLOHH_05420 in Escherichia coli ECOR27

Name: metA
Annotation: homoserine O-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 137 to 153 (17 residues), see Phobius details TIGR01001: homoserine O-succinyltransferase" amino acids 1 to 302 (302 residues), 558 bits, see alignment E=3e-172 PF04204: HTS" amino acids 2 to 299 (298 residues), 446.5 bits, see alignment E=1.9e-138

Best Hits

Swiss-Prot: 100% identical to METAS_ECOHS: Homoserine O-succinyltransferase (metAS) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K00651, homoserine O-succinyltransferase [EC: 2.3.1.46] (inferred from 99% identity to ebd:ECBD_4024)

MetaCyc: 98% identical to homoserine O-succinyltransferase (Escherichia coli K-12 substr. MG1655)
Homoserine O-succinyltransferase. [EC: 2.3.1.46]

Predicted SEED Role

"Homoserine O-succinyltransferase (EC 2.3.1.46)" in subsystem Methionine Biosynthesis (EC 2.3.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>NOLOHH_05420 homoserine O-succinyltransferase (Escherichia coli ECOR27)
MPIRVPDELPAVNFLREENVFVMTTSRASGQEIRPLKVLILNLMPKKIETENQFLRLLSN
SPLQVDIQLLRIDSRESRNTPAEHLNNFYCNFEDIQEQNFDGLIVTGAPLGLVEFNDVAY
WPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTRTDKLSGVYEHHILHPHALLT
RGFDDSFLAPHSRYADFPAALIRDYTDLEILAETEEGDAYLFASKDKRIAFVTGHPEYDA
QTLAQEYFRDVEAGLGPEVPYNYFPHNDPQNTPRASWRSHGNLLFTNWLNYYVYQITPYD
LRHMNPTLD