Protein Info for NOLOHH_05120 in Escherichia coli ECOR27

Name: soxR
Annotation: redox-sensitive transcriptional activator SoxR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01950: redox-sensitive transcriptional activator SoxR
  • amino acids 12 to 152 (141 residues), 248.1 bits, E=1e-78
• PF13411: MerR_1
  • amino acids 13 to 75 (63 residues), 42.8 bits, E=6.7e-15
• PF00376: MerR
  • amino acids 13 to 49 (37 residues), 52 bits, E=7.2e-18
• PF09278: MerR-DNA-bind
  • amino acids 54 to 119 (66 residues), 58.6 bits, E=1.2e-19

Best Hits

Swiss-Prot: 100% identical to SOXR_ECOLI: Redox-sensitive transcriptional activator SoxR (soxR) from Escherichia coli (strain K12)

KEGG orthology group: K13639, MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR (inferred from 100% identity to eco:b4063)

Predicted SEED Role

"Redox-sensitive transcriptional activator SoxR" in subsystem Oxidative stress

Protein Sequence (154 amino acids)

>NOLOHH_05120 redox-sensitive transcriptional activator SoxR (Escherichia coli ECOR27)
MEKKLPRIKALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAII
KIAQRIGIPLATIGEAFGVLPEGHTLSAKEWKQLSSQWREELDRRIHTLVALRDELDGCI
GCGCLSRSDCPLRNPGDRLGEEGTGARLLEDEQN