Protein Info for NOLOHH_04885 in Escherichia coli ECOR27

Name: phnC
Annotation: phosphonate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02315: phosphonate ABC transporter, ATP-binding protein
  • amino acids 4 to 250 (247 residues), 347.9 bits, E=1.4e-108
• PF00005: ABC_tran
  • amino acids 20 to 181 (162 residues), 133.6 bits, E=7.9e-43

Best Hits

Swiss-Prot: 99% identical to PHNC_ECOL5: Phosphonates import ATP-binding protein PhnC (phnC) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 99% identity to eco:b4106)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Protein Sequence (262 amino acids)

>NOLOHH_04885 phosphonate ABC transporter ATP-binding protein (Escherichia coli ECOR27)
MQTIIRVEKLAKTFNQHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSA
GSHIELLGRTVQREGRLARDIRKSRANTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRT
CFSWFTGEQKQRALQALTRVGMVHFAHQRVSTLSGGQQQRVAIARALMQQAKVILADEPI
ASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALRQGHVFYDGSSQQF
DNERFDHLYRSINRIEENAKAA