Protein Info for NOLOHH_03900 in Escherichia coli ECOR27

Name: fimH
Annotation: type 1 fimbria D-mannose specific adhesin FimH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF09160: FimH_man-bind" amino acids 24 to 168 (145 residues), 244.3 bits, see alignment E=3.6e-77 PF00419: Fimbrial" amino acids 178 to 300 (123 residues), 36.5 bits, see alignment E=6e-13

Best Hits

Swiss-Prot: 100% identical to FIMH_ECOLI: Type 1 fimbrin D-mannose specific adhesin (fimH) from Escherichia coli (strain K12)

KEGG orthology group: K07350, minor fimbrial subunit (inferred from 100% identity to eco:b4320)

Predicted SEED Role

"mannose-specific adhesin FimH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>NOLOHH_03900 type 1 fimbria D-mannose specific adhesin FimH (Escherichia coli ECOR27)
MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLS
TQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRT
DKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG
GCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQ
GVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ