Protein Info for NOLOHH_03740 in Escherichia coli ECOR27

Name: hpaI
Annotation: 4-hydroxy-2-oxoheptanedioate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR02311: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase" amino acids 3 to 250 (248 residues), 433.6 bits, see alignment E=1e-134 PF03328: HpcH_HpaI" amino acids 15 to 241 (227 residues), 223.6 bits, see alignment E=9.7e-71

Best Hits

Swiss-Prot: 100% identical to HPCH_ECOHS: 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase (hpcH) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 99% identity to sbo:SBO_4407)

MetaCyc: 99% identical to 4-hydroxy-2-ketopimelate aldolase monomer (Escherichia coli C)
4-HYDROXY-2-KETOPIMELATE-LYSIS-RXN [EC: 4.1.2.52]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.-

Use Curated BLAST to search for 4.1.2.- or 4.1.2.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>NOLOHH_03740 4-hydroxy-2-oxoheptanedioate aldolase (Escherichia coli ECOR27)
MENSFKAALKAGRPQIGLWLGLSSSYSAELLAGAGFDWLLIDGEHAPNNVQTVLTQLQAI
APYPSQPVVRPSWNDPVQIKQLLDVGTQTLLVPMVQNADEAREAVRATRYPPAGIRGVGS
ALARASRWNRIPDYLQKANDQMCVLVQIETREAMKNLPQILDVEGVDGVFIGPADLSADM
GYAGNPQHPEVQAAIEQAIVQIREAGKAPGILIANEQLAKRYLELGALFVAVGVDTTLLA
RAAEALAARFGAQATTVKPGVY