Protein Info for NOLOHH_03610 in Escherichia coli ECOR27

Name: rimI
Annotation: ribosomal protein S18-alanine N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01575: ribosomal-protein-alanine acetyltransferase
  • amino acids 11 to 142 (132 residues), 159.4 bits, E=2.6e-51
• PF00583: Acetyltransf_1
  • amino acids 14 to 120 (107 residues), 76.8 bits, E=6e-25
• PF13420: Acetyltransf_4
  • amino acids 19 to 131 (113 residues), 32 bits, E=4.2e-11
• PF13673: Acetyltransf_10
  • amino acids 37 to 123 (87 residues), 50.1 bits, E=9.8e-17
• PF13480: Acetyltransf_6
  • amino acids 43 to 100 (58 residues), 26.2 bits, E=2.9e-09
• PF12746: GNAT_acetyltran
  • amino acids 43 to 122 (80 residues), 36.2 bits, E=1.9e-12
• PF13508: Acetyltransf_7
  • amino acids 46 to 121 (76 residues), 56 bits, E=1.5e-18
• PF08445: FR47
  • amino acids 59 to 123 (65 residues), 47.6 bits, E=4.8e-16

Best Hits

Swiss-Prot: 99% identical to RIMI_ECOLI: [Ribosomal protein S18]-alanine N-acetyltransferase (rimI) from Escherichia coli (strain K12)

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 99% identity to eco:b4373)

MetaCyc: 99% identical to protein N-acetyltransferase RimI (Escherichia coli K-12 substr. MG1655)
2.3.1.128-RXN [EC: 2.3.1.266]; 2.3.1.- [EC: 2.3.1.266]

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128 or 2.3.1.266

Protein Sequence (148 amino acids)

>NOLOHH_03610 ribosomal protein S18-alanine N-acetyltransferase (Escherichia coli ECOR27)
MNTISSLETTDLPAAYHIEQRAHAFPWSEKTFASNQGERYLNFQLTQNGKMAAFAITQVV
LDEATLFNIAVDPDYQRQGLGRVLLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGF
NEATIRRNYYPTTDGREDAIIMALPISM