Protein Info for NOLOHH_03235 in Escherichia coli ECOR27

Name: caiT
Annotation: L-carnitine/gamma-butyrobetaine antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 408 to 430 (23 residues), see Phobius details amino acids 446 to 468 (23 residues), see Phobius details amino acids 474 to 495 (22 residues), see Phobius details PF02028: BCCT" amino acids 14 to 500 (487 residues), 403.3 bits, see alignment E=6.6e-125 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 52 to 501 (450 residues), 559.7 bits, see alignment E=2.2e-172

Best Hits

Swiss-Prot: 100% identical to CAIT_ECOUT: L-carnitine/gamma-butyrobetaine antiporter (caiT) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K05245, L-carnitine/gamma-butyrobetaine antiporter (inferred from 100% identity to eco:b0040)

MetaCyc: 100% identical to L-carnitine:gamma-butyrobetaine antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-100

Predicted SEED Role

"L-carnitine/gamma-butyrobetaine antiporter"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>NOLOHH_03235 L-carnitine/gamma-butyrobetaine antiporter (Escherichia coli ECOR27)
MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFSYVTNVWGWAFEWYMV
VMLFGWFWLVFGPYAKKRLGNEPPEFSTASWIFMMFASCTSAAVLFWGSIEIYYYISTPP
FGLEPNSTGAKELGLAYSLFHWGPLPWATYSFLSVAFAYFFFVRKMEVIRPSSTLVPLVG
EKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWLFGIPHTLQLDAIIITCWI
ILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASFIMNYFTDSVGMLLMYLPRM
LFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISRGRTVRELCFGMVLGLTASTW
ILWTVLGSNTLLLIDKNIINIPNLIEQYGVARAIIETWAALPLSTATMWGFFILCFIATV
TLVNACSYTLAMSTCREVRDGEEPPLLVRIGWSILVGIIGIVLLALGGLKPIQTAIIAGG
CPLFFVNIMVTLSFIKDAKQNWKD