Protein Info for NOLOHH_02770 in Escherichia coli ECOR27

Name: yadI
Annotation: Putative phosphotransferase enzyme IIA component YadI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03610: EIIA-man
  • amino acids 3 to 116 (114 residues), 107.2 bits, E=2.9e-35

Best Hits

Swiss-Prot: 99% identical to YADI_ECOLI: Putative phosphotransferase enzyme IIA component YadI (yadI) from Escherichia coli (strain K12)

KEGG orthology group: K02821, PTS system, ascorbate-specific IIA component [EC: 2.7.1.69] (inferred from 99% identity to eco:b0129)

MetaCyc: 99% identical to putative PTS enzyme IIA component YadI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Putative PTS system IIA component yadI (EC 2.7.1.69)" (EC 2.7.1.69)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (146 amino acids)

>NOLOHH_02770 Putative phosphotransferase enzyme IIA component YadI (Escherichia coli ECOR27)
MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLSRMMCDALHEADSGEG
VIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACRETMTSSEFRERIVELG
GPEVSSLWHQQQKNPPFVLKHNLYEY