Protein Info for NOLOHH_02760 in Escherichia coli ECOR27

Name: panD
Annotation: aspartate 1-decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00223: aspartate 1-decarboxylase
  • amino acids 1 to 126 (126 residues), 227.9 bits, E=1.2e-72
• PF02261: Asp_decarbox
  • amino acids 1 to 114 (114 residues), 158.3 bits, E=3.3e-51

Best Hits

Swiss-Prot: 100% identical to PAND_SHISS: Aspartate 1-decarboxylase (panD) from Shigella sonnei (strain Ss046)

KEGG orthology group: K01579, aspartate 1-decarboxylase [EC: 4.1.1.11] (inferred from 100% identity to eco:b0131)

MetaCyc: 100% identical to aspartate 1-decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate 1-decarboxylase (EC 4.1.1.11)" in subsystem Coenzyme A Biosynthesis (EC 4.1.1.11)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• β-alanine biosynthesis III (1/1 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pantothenate and CoA biosynthesis
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.11

Protein Sequence (126 amino acids)

>NOLOHH_02760 aspartate 1-decarboxylase (Escherichia coli ECOR27)
MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI
AAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKA
IPVQVA