Protein Info for NOLOHH_01765 in Escherichia coli ECOR27

Annotation: bifunctional 2-methylcitrate dehydratase/aconitate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 TIGR02330: 2-methylcitrate dehydratase" amino acids 13 to 483 (471 residues), 928 bits, see alignment E=5e-284 PF03972: MmgE_PrpD_N" amino acids 18 to 270 (253 residues), 319.4 bits, see alignment E=1.3e-99 PF19305: MmgE_PrpD_C" amino acids 287 to 462 (176 residues), 198.7 bits, see alignment E=6.7e-63

Best Hits

Swiss-Prot: 100% identical to PRPD_ECOLI: 2-methylcitrate dehydratase (prpD) from Escherichia coli (strain K12)

KEGG orthology group: K01720, 2-methylcitrate dehydratase [EC: 4.2.1.79] (inferred from 100% identity to eco:b0334)

MetaCyc: 100% identical to 2-methylcitrate dehydratase (Escherichia coli K-12 substr. MG1655)
2-methylcitrate dehydratase. [EC: 4.2.1.79]

Predicted SEED Role

"2-methylcitrate dehydratase (EC 4.2.1.79)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.2.1.79)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>NOLOHH_01765 bifunctional 2-methylcitrate dehydratase/aconitate hydratase (Escherichia coli ECOR27)
MSAQINNIRPEFDREIVDIVDYVMNYEISSKVAYDTAHYCLLDTLGCGLEALEYPACKKL
LGPIVPGTVVPNGVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDTWLAAEWGHPSDNLGGI
LATADWLSRNAVASGKAPLTMKQVLTAMIKAHEIQGCIALENSFNRVGLDHVLLVKVAST
AVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKSWAAGDATSRAVRLALMAK
TGEMGYPSALTAPVWGFYDVSFKGESFRFQRPYGSYVMENVLFKISFPAEFHSQTAVEAA
MTLYEQMQAAGKTAADIEKVTIRTHEACIRIIDKKGPLNNPADRDHCIQYMVAIPLLFGR
LTAADYEDNVAQDKRIDALREKINCFEDPAFTADYHDPEKRAIANAITLEFTDGTRFEEV
VVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQRILEVSLDRTRLEQMPVNEYLDL
YVI