Protein Info for NOLOHH_01000 in Escherichia coli ECOR27

Name: cueR
Annotation: Cu(I)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 1 to 126 (126 residues), 207.4 bits, see alignment E=3.2e-66 PF13411: MerR_1" amino acids 1 to 66 (66 residues), 68.4 bits, see alignment E=7.1e-23 PF00376: MerR" amino acids 2 to 39 (38 residues), 56.5 bits, see alignment E=2.8e-19 PF09278: MerR-DNA-bind" amino acids 45 to 108 (64 residues), 63.3 bits, see alignment E=4e-21

Best Hits

Swiss-Prot: 100% identical to CUER_SHIFL: HTH-type transcriptional regulator CueR (cueR) from Shigella flexneri

KEGG orthology group: K11923, MerR family transcriptional regulator, copper efflux regulator (inferred from 100% identity to eco:b0487)

Predicted SEED Role

"HTH-type transcriptional regulator cueR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>NOLOHH_01000 Cu(I)-responsive transcriptional regulator (Escherichia coli ECOR27)
MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLNELTLLRQARQVGFNL
EESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRDQLLALANACPGDDSADC
PIIENLSGCCHHRAG