Protein Info for NIAGMN_28720 in Escherichia coli ECRC102

Name: yncB
Annotation: Uncharacterized endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00565: SNase" amino acids 44 to 140 (97 residues), 106.9 bits, see alignment E=3.9e-35

Best Hits

Swiss-Prot: 100% identical to YFI3_ECO57: Uncharacterized endonuclease (L7003) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eoi:ECO111_p3-11)

Predicted SEED Role

"FIG01068181: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>NIAGMN_28720 Uncharacterized endonuclease (Escherichia coli ECRC102)
MRKYIPLVLFIFSWPVLCADIHGRVVRVLDGDTIEVMDSRKAVRIRLVNIDAPEKKQDYG
RWSTDMMKSLVAGKTVTVTYFQRDRYGRMLGQVYAPDGMNVNQFMVRAGAAWVYEQYNTD
PVLPVLQNEARQQKRGLWSDADPVPPWIWRHRK