Protein Info for NIAGMN_28595 in Escherichia coli ECRC102

Name: gspF
Annotation: type II secretion system inner membrane protein GspF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 171 to 194 (24 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 372 to 399 (28 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 404 (401 residues), 511.5 bits, see alignment E=9.9e-158 PF00482: T2SSF" amino acids 73 to 195 (123 residues), 107.9 bits, see alignment E=1.8e-35 amino acids 276 to 397 (122 residues), 102.9 bits, see alignment E=6.4e-34

Best Hits

Swiss-Prot: 76% identical to GSPF_PECCC: Type II secretion system protein F (outF) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 100% identity to etw:ECSP_6005)

MetaCyc: 52% identical to type II secretion system protein GspF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>NIAGMN_28595 type II secretion system inner membrane protein GspF (Escherichia coli ECRC102)
MALFHYQASDIHGRKRSGILEADSARHARQLLREQALIPVRLDEKQVHHKHSLRSILRFR
PRGGSSAELALLTRQLATLVAASLPLEEALDALLRQSEKPRQRNLIAAVRTKVLEGHSLA
AAMGMFPGTFERLYCAMVAAGETSGRLDVVLSRLADYTEQRQIMRNRLLQALLYPCVLTL
VAVGVIAILLTAVVPKVVEQFIHMKQTLPLSTRVLMGAAEVSQTWGPWLLLAAALGGIAG
RMILHQPSQRLAFHHLLLRLPVVGRISRGLNTARYARTLSILNASAVPLLQAMHISGDVL
SNDWARHQLATAAELVREGVSLHQALEQTSLFPPMMRHMIASGENSGELDSMLERAADNQ
DREFSTQMQLALGLFEPLLVVGMAGVVLFIVLAILQPLLQLNNMMNM