Protein Info for NIAGMN_28105 in Escherichia coli ECRC102

Annotation: Prophage tail fibre N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 971 PF08400: phage_tail_N" amino acids 1 to 134 (134 residues), 241.3 bits, see alignment E=4.9e-76 PF03406: Phage_fiber_2" amino acids 462 to 502 (41 residues), 68.4 bits, see alignment (E = 6.5e-23) amino acids 506 to 546 (41 residues), 66.6 bits, see alignment (E = 2.4e-22) amino acids 550 to 590 (41 residues), 66.5 bits, see alignment (E = 2.5e-22) PF07484: Collar" amino acids 761 to 808 (48 residues), 44.5 bits, see alignment 2.4e-15 PF03335: Phage_fiber" amino acids 824 to 837 (14 residues), 11.5 bits, see alignment (E = 5.8e-05) amino acids 856 to 869 (14 residues), 14 bits, see alignment (E = 9.1e-06) amino acids 871 to 881 (11 residues), 6.7 bits, see alignment (E = 0.0021) amino acids 906 to 919 (14 residues), 11.1 bits, see alignment (E = 7.9e-05) amino acids 921 to 932 (12 residues), 9.9 bits, see alignment (E = 0.00019) amino acids 930 to 941 (12 residues), 9.4 bits, see alignment (E = 0.00029)

Best Hits

KEGG orthology group: None (inferred from 98% identity to eoh:ECO103_0559)

Predicted SEED Role

"Phage tail fiber protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (971 amino acids)

>NIAGMN_28105 Prophage tail fibre N-terminal (Escherichia coli ECRC102)
MAVKISGVLKDGTGKPVENCTIQLKARRNSATVVVNTVASENPDEAGRYSMDVEYGQYSV
ILLVEGFPPSHAGTITVYEDSQPGTLNDFLGAMTEDDVRPEALRRFELMVEEVARNASAV
AQNTAAAKKSASDASTSAREAATHATDAADSARAASTSAGQAASSAQSASSSAGTASTKA
TEASKSAAAAESSKSAAATSAGAAKTSETNAAVSQQSAATSASTATTKASEAASSARDAS
ASKEAAKSSETSAASSASSAASSATAAGNSAKAAKTSETNAKSSETAAEQSASAAAGSKT
AAALSASAASTSAGQASASATAAGKSAESAASSASTATTKAGEATEQASAAASSASAAKT
SETNAKASETSAESSKTAAASSASSAASSASSASASKDEATRQASAAKSSATTASTKATE
AAGSATAAAQSKSTAESAATRAETAAKRAEDIASAVALEDASTTKKGIVQLSSATNSTSE
SLAATPKAVKAAYELANGKYTAQDATTAQKGIVQLSNATNSTSEMLAATPKSVKAAYDLA
NGKYTAQDATTAQKGIVQLSSATNSASETLAATPKAVKAANDNANGRVPSARKVNGKALS
SDITLTPKDIGTLNSTTMSFSGGAGWFKLATVTMPQASSVVSITLIGGAGFNVGSPQQAG
ISELVLRAGNGNPKGITGALWQRTSTGFTNFAWVNTSGDTYDIYVAIGNYATGVNIQWDY
TSNASVTIHTSPAYSANKPEGLTDGTVYSLYTPSEQFYPPGAPIPWPSDTVPSGYALMQG
QTFDKSAYPKLAAAYPSGVIPDMRGWTIKGKPASGRAVLSQEQDGIKSHTHSASASSTDL
GTKTTSSFDYGTKSTNNTGAHTHSVSGTAASAGNHTHSVTGASAVSQWSQNGSVHKVVSA
ASVNTSAAGAHTHSVSGTAASAGAHAHTVGIGAHTHSVAIGSHGHTITVNAAGNAENTVK
NIAFNYIVRLA