Protein Info for NIAGMN_28070 in Escherichia coli ECRC102

Name: ybcY
Annotation: Putative uncharacterized protein YbcY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF13489: Methyltransf_23" amino acids 52 to 182 (131 residues), 27.9 bits, see alignment E=3.5e-10 PF08242: Methyltransf_12" amino acids 58 to 155 (98 residues), 36.6 bits, see alignment E=1.3e-12 PF08241: Methyltransf_11" amino acids 58 to 156 (99 residues), 24 bits, see alignment E=1e-08

Best Hits

Swiss-Prot: 99% identical to YBCY_ECOLI: Putative uncharacterized protein YbcY (ybcY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sbo:SBO_0952)

Predicted SEED Role

"Putative SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>NIAGMN_28070 Putative uncharacterized protein YbcY (Escherichia coli ECRC102)
MVKLMKKNTDDGAKIYTPLTLKLYDWWVLGVSNRLAWGCPTKEHLLPHFLEHLGNNHLDI
GVGTGFYLTHVPESSLISLMDLNEASLNAASTRAGESKIKHKISHDVFEPYPAALHGQFD
SISMFYLLHCLPGNISTKSCVIRNAAQALTDDGTLYGATILGDGVVHNSFGQKLMRIYNQ
KGIFSNTKDSEEGLTHILSEHFENVKTKVQGTVVMFSASGKK