Protein Info for NIAGMN_27880 in Escherichia coli ECRC102

Name: modD
Annotation: Putative pyrophosphorylase ModD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR01334: modD protein" amino acids 2 to 278 (277 residues), 505.2 bits, see alignment E=2.5e-156 PF02749: QRPTase_N" amino acids 18 to 104 (87 residues), 78.7 bits, see alignment E=2.8e-26 PF01729: QRPTase_C" amino acids 112 to 276 (165 residues), 109.6 bits, see alignment E=1.5e-35

Best Hits

Swiss-Prot: 100% identical to MODD_ECO57: Putative pyrophosphorylase ModD (modD) from Escherichia coli O157:H7

KEGG orthology group: K03813, molybdenum transport protein [EC: 2.4.2.-] (inferred from 97% identity to ecm:EcSMS35_1951)

Predicted SEED Role

"Molybdenum transport system protein ModD" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>NIAGMN_27880 Putative pyrophosphorylase ModD (Escherichia coli ECRC102)
MIFLSQAQIDALLLEDIQGGDLTTRALNIGHQHGYIEFFLRQGGCVSGVSVACKMLTTLG
LTIDDAVSDGSQANAGQRLIRAQGNAAALHQGWKAIQNVLEWSCGVSDYLDQMLALLRER
YPDGNIACTRKAIPGTRLLASQAILAAGGLIHRAGCAETILLFANHRHFLHDNQDWSGAI
NQLRRHAPEKKIVVEADTPKEAIAALRAQPDVLQLDKFSPQQATEIAQIAPSLAPHCTLA
LTGGINLTTLKNYLDCGIRLFITSAPYYAAPADIKVSLQPAASI