Protein Info for NIAGMN_25935 in Escherichia coli ECRC102

Name: hslJ
Annotation: heat shock protein HslJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03724: META" amino acids 28 to 132 (105 residues), 86.5 bits, see alignment E=6e-29

Best Hits

Swiss-Prot: 99% identical to HSLJ_ECOLI: Heat shock protein HslJ (hslJ) from Escherichia coli (strain K12)

KEGG orthology group: K03668, heat shock protein HslJ (inferred from 99% identity to eco:b1379)

Predicted SEED Role

"Heat shock protein hslJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>NIAGMN_25935 heat shock protein HslJ (Escherichia coli ECRC102)
MKKVAAFVALSLLMAGCVSNDKIAVTPEQLQHHRFVLESVNGKPVTCDKNPPEISFGEKM
MISGSMCNRFSGEGKLSNGELTAKGLAMTRMMCANPQLNELDNTISEMLKEGAQVDLTAN
QLTLATAKQTLTYKLADLMN