Protein Info for NIAGMN_25400 in Escherichia coli ECRC102

Name: yddA
Annotation: Inner membrane ABC transporter ATP-binding protein YddA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 184 to 200 (17 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 19 to 292 (274 residues), 148.2 bits, see alignment E=4.9e-47 PF05992: SbmA_BacA" amino acids 23 to 341 (319 residues), 116.3 bits, see alignment E=3.1e-37 PF00005: ABC_tran" amino acids 374 to 506 (133 residues), 62.4 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 100% identical to YDDA_ECOLI: Inner membrane ABC transporter ATP-binding protein YddA (yddA) from Escherichia coli (strain K12)

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to eco:b1496)

Predicted SEED Role

"Hypothetical ABC transporter ATP-binding protein yddA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>NIAGMN_25400 Inner membrane ABC transporter ATP-binding protein YddA (Escherichia coli ECRC102)
MLIAKYLCLLKPFWLRKNNKTSVLLIIIILAMILGVVKIQVWLNDWNNDFFNALSQKETD
KLWQLVLWFPALLGIFVLISVNKTWLIKLLTIRWREWLTDYYLNRWFADKNYYFTQIYGE
HKNTDNPDQRIAEDILLLISKTLSLSFGFIQSLSMLITFTVILWQSAGMLSFTVGGTEWN
IQGYMVYTVVLIVIGGTLFTHKVGKRIRPLNVEKQRSEATFRTNLVQHNKQAELIALSNA
ESLQRQELSDNFHTIKENWHRLMNRQRWLDYWQNIYSRSLSVLPYFLLLPQFISGQINLG
GLMKSRQAFMLVSNNLSWFIYKYDELAELAAVIDRLYEFHQLTEQRPTNKPKNCQHAVQV
ADASIRTPDNKIILENLNFHVSPGKWLLLKGYSGAGKTTLLKTLSHCWPWFKGDISSPAD
SWYVSQTPLIKTGLLKEIICKALPLPVDDKSLSEVLHQVGLGKLAARIHDHDRWGDILSS
GEKQRIALARLILRRPKWIFLDETTSHLEEQEAIRLLRLVREKLPTSGVIMVTHQPGVWN
LADDICDISAVL