Protein Info for NIAGMN_24705 in Escherichia coli ECRC102

Name: nleL
Annotation: type III secretion system effector E3 ubiquitin ligase NleL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 782 PF00805: Pentapeptide" amino acids 204 to 240 (37 residues), 24.9 bits, see alignment 3.1e-09 amino acids 236 to 267 (32 residues), 24.9 bits, see alignment (E = 2.9e-09) PF13981: SopA" amino acids 379 to 508 (130 residues), 49.8 bits, see alignment E=1.2e-16 PF13979: SopA_C" amino acids 619 to 782 (164 residues), 114.7 bits, see alignment E=9.9e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to eoi:ECO111_1468)

Predicted SEED Role

"Putative secreted effector protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (782 amino acids)

>NIAGMN_24705 type III secretion system effector E3 ubiquitin ligase NleL (Escherichia coli ECRC102)
MLPTTNISVNSGVISFESPVDSPSNEDVEVALEKWCAEGEFSENRHEVASKILDVISTNG
ETLSISEPITTLPDLLPGSLKELVLNGCTELKSINCLPPNLSSLSMVGCSSLEVINCSIP
ENVINLSLCHCSSLKHIEGSFPEALRNSVYLNGCNSLNESQCQFLAYDVSQGRACLSKAE
LTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQ
AVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILN
EADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKS
NKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNAN
IQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMN
GSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQ
DDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYH
KAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWEL
NAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLI
EQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVA
WR