Protein Info for NIAGMN_24005 in Escherichia coli ECRC102
Name: csgC
Annotation: curli assembly protein CsgC
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CSGC_ECO45: Curli assembly protein CsgC (csgC) from Escherichia coli O45:K1 (strain S88 / ExPEC)
KEGG orthology group: K04336, curli production protein (inferred from 98% identity to eco:b1043)Predicted SEED Role
"Putative curli production protein CsgC" in subsystem Curli production
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (110 amino acids)
>NIAGMN_24005 curli assembly protein CsgC (Escherichia coli ECRC102) MNALLLLAALSSQITFNTTQQGDMYTIIPEVTLTQSCLCRVQILSLREGSSGQSQTKQEK TLSLPANQPIALTKLSLNISPDDRVKIVVTVSDGQSLHLSQQWPPSSEKS