Protein Info for NIAGMN_23700 in Escherichia coli ECRC102
Name: rutE
Annotation: malonic semialdehyde reductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RUTE_ECO5E: Probable malonic semialdehyde reductase RutE (rutE) from Escherichia coli O157:H7 (strain EC4115 / EHEC)
KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 97% identity to eck:EC55989_1119)MetaCyc: 97% identical to putative malonic semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
RXN-8974 [EC: 1.1.1.298]
Predicted SEED Role
"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization
MetaCyc Pathways
- uracil degradation III (5/5 steps found)
- β-alanine degradation III (1/2 steps found)
- 3-hydroxypropanoate cycle (7/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
- glyoxylate assimilation (5/13 steps found)
- superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.298
Use Curated BLAST to search for 1.-.-.- or 1.1.1.298
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (196 amino acids)
>NIAGMN_23700 malonic semialdehyde reductase (Escherichia coli ECRC102) MNEAVSPGALSTLFTDARTHNGWRETPVSDETLRELYALMKWGPTSANCSPARIVFIRTA EGKERLRPALSSGNLQKTLTAPVTAIVAWDSEFYERLPQLFPHGDARSWFTSSPQLAEET AFRNSSMQAAYLIIACRALGLDTGPMSGFDRQHVDDAFFAGSTLKSNLLINIGYGDSSKL FARLPRLSFEEACGLL