Protein Info for NIAGMN_23440 in Escherichia coli ECRC102

Name: stxA2c
Annotation: Shiga toxin Stx2c subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00161: RIP" amino acids 31 to 231 (201 residues), 103.6 bits, see alignment E=5.4e-34

Best Hits

Swiss-Prot: 100% identical to STXA_BP933: Shiga-like toxin 2 subunit A (stxA2) from Enterobacteria phage 933W

KEGG orthology group: K11006, shiga toxin subunit A (inferred from 100% identity to eoi:ECO111_2430)

MetaCyc: 55% identical to Shiga toxin subunit A (Shigella dysenteriae)
3.2.2.-

Predicted SEED Role

"Shiga-like toxin II subunit A precursor (EC 3.2.2.22)" (EC 3.2.2.22)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.22

Use Curated BLAST to search for 3.2.2.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>NIAGMN_23440 Shiga toxin Stx2c subunit A (Escherichia coli ECRC102)
MKCILFKWVLCLLLGFSSVSYSREFTIDFSTQQSYVSSLNSIRTEISTPLEHISQGTTSV
SVINHTPPGSYFAVDIRGLDVYQARFDHLRLIIEQNNLYVAGFVNTATNTFYRFSDFTHI
SVPGVTTVSMTTDSSYTTLQRVAALERSGMQISRHSLVSSYLALMEFSGNTMTRDASRAV
LRFVTVTAEALRFRQIQREFRQALSETAPVYTMTPGDVDLTLNWGRISNVLPEYRGEDGV
RVGRISFNNISAILGTVAVILNCHHQGARSVRAVNEESQPECQITGDRPVIKINNTLWES
NTAAAFLNRKSQFLYTTGK