Protein Info for NIAGMN_22680 in Escherichia coli ECRC102

Name: ycdB
Annotation: putative transcriptional regulatory protein YcdB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 2 to 235 (234 residues), 218.6 bits, see alignment E=5.3e-69 PF20772: TACO1_YebC_N" amino acids 3 to 74 (72 residues), 89.5 bits, see alignment E=1.6e-29 PF01709: Transcrip_reg" amino acids 83 to 235 (153 residues), 174.2 bits, see alignment E=1.8e-55

Best Hits

Swiss-Prot: 100% identical to YEEN_ECO57: Probable transcriptional regulatory protein YeeN (yeeN) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eco:b1983)

Predicted SEED Role

"FIG007491: hypothetical protein YeeN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>NIAGMN_22680 putative transcriptional regulatory protein YcdB (Escherichia coli ECRC102)
VGRKWANIVAKKTAKDGATSKIYAKFGVEIYAAAKQGEPDPELNTSLKFVIERAKQAQVP
KHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMIIAETLTSNVNRTIANVRTIFNKKGGN
IGAAGSVSYMFDNTGVIVFKGSDPDHIFEILLEAEVDVRDVTEEEGNIVIYTEPTDLHKG
IAALKAAGISEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVANL