Protein Info for NIAGMN_22670 in Escherichia coli ECRC102

Annotation: EmmdR/YeeO family multidrug/toxin efflux MATE transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details amino acids 341 to 366 (26 residues), see Phobius details PF01554: MatE" amino acids 37 to 197 (161 residues), 127.9 bits, see alignment E=1.5e-41 amino acids 267 to 368 (102 residues), 42.7 bits, see alignment E=2.4e-15 TIGR00797: MATE efflux family protein" amino acids 37 to 368 (332 residues), 178.4 bits, see alignment E=1.1e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to ece:Z3144)

Predicted SEED Role

"FIG01069516: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>NIAGMN_22670 EmmdR/YeeO family multidrug/toxin efflux MATE transporter (Escherichia coli ECRC102)
LNISSALRQVVHGTRWHAKRKSYKVLFWREITPFAVPIFMENACVLLMGVLSTFLVSWLG
KDAMAGVGLADSFNMVIMAFFAAIDLGTTVVVAFSLGKRDRRRARVATRQSLVIMTLFAV
LLATLIHHFGEQIIDFVAGDATTEVKALALTYLELTVLSYPAAAITLIGSGALRGAGNTK
IPLLINGSLNILNIIISGILIYGLFSWPGLGFVGAGLGLTISRYIGAVAILWVLAIGFNP
ALRISLKSYFKPLNFSIIWEVMGIGIPASVESVLFTSGRLLTQMFVAGMGTSVIAGNFIA
FSIAALINLPGSALGSASTIITGRRLGVGQIAQAEIQLRHVFWLTTLGLTAIAWLTAPFA
GVMASFYT